Karen Lynne Creates

I make it. I blog it. You see it.

Menu

Skip to content
  • Home

Author Archives: Karen

Blue Starfish

scan0214

Image 09/18/2018Karen Drawings 5 Comments
bluecolored penslinesmarkerspensstarfish

Triangles Pendant

Image 09/17/2018Karen Beaded 1 Comment
BeadBeadsbeadworkbeigebrownpendantpeyote stitch

A Gift!

09/16/2018Karen crochet 1 Comment

A coworker was going through her mother’s belongings and found this crocheted bag. It’s made from strips of plastic cut from grocery bags. It’s the perfect size for small projects. I love it.

 

 

 

 

 

 

Here’s a closeup of the border.

bagbrowncrochetplasticplastic bagstan

Song

scan0249via Song

Quote 09/15/2018Karen the Daily Post 1 Comment
Buddycatdaily postdaily promptdaily wordhumorsongthe Daily Postword of the day

Diamonds

09/14/2018Karen crochet 1 Comment

This interlocking crochet pattern is called Diamonds.

 

 

 

 

 

The back side.

crochetinterlockinginterlocking crochetInterlocking Crochet PatternspinkpurpleTanis Galik

“Help!”

09/13/2018Karen animals 2 Comments

“Make him leave me alone!”

animalsBuddycatkittencatshumorpetsTheo

Acrylic #9

100_4200

Image 09/12/2018Karen Acrylic Paint 1 Comment
acrylicacrylic paintartbluepaintpink

Purple and Teal Butterfly

scan0213

Image 09/11/2018Karen Drawings 1 Comment
butterflydrawdrawinglinesmarkerpurpleteal

Crochet Lavender and Purple on Purple

09/10/2018Karen crochet 1 Comment

100_4183

scan0220

beadedBeadsBraceletcrochetcufflavenderpurple

Scrape #8

100_4193

Image 09/09/2018Karen Acrylic Paint 3 Comments
acrylicacrylic paintpaintpurpleredscrape

Post navigation

« Older posts
Newer posts »

Enter your email address to follow this blog and receive notifications of new posts by email.

Join 724 other subscribers

Table of Contents

How many people have seen my BLOG?

  • 41,788 hits

What’s being said:

mtetar's avatarmtetar on Tulip and Balloon Crochet Scar…
Sandy Jandik's avatarSandy Jandik on Christmas and Snowman Scarf Cr…
Sandy Jandik's avatarSandy Jandik on Little Shells
Sandy Jandik's avatarSandy Jandik on Motif #30
puppymellow089c4d9672's avatarpuppymellow089c4d967… on Motif #30
Blog at WordPress.com.
Karen Lynne Creates
Blog at WordPress.com.
  • Subscribe Subscribed
    • Karen Lynne Creates
    • Join 622 other subscribers
    • Already have a WordPress.com account? Log in now.
    • Karen Lynne Creates
    • Subscribe Subscribed
    • Sign up
    • Log in
    • Report this content
    • View site in Reader
    • Manage subscriptions
    • Collapse this bar

Loading Comments...