Karen Lynne Creates

I make it. I blog it. You see it.

Menu

Skip to content
  • Home

Tag Archives: butterfly

Butterfly

Image 11/01/2024Karen crochet 1 Comment
75 Lace Crochet MotifsbutterflyCaitlin Sainiocrochet

Butterfly

Image 09/27/2022Karen Drawings 1 Comment
artbutterflycreativedrawdrawingfunplay

Mosaic Butterfly

11/22/2021Karen crochet 1 Comment

Got this pattern on Pinterest. Not sure the variegated yarn was a good idea.

butterflycrochetmosaicmosaic crochetPinterestsamples

Butterfly

10/25/2021Karen animals, crochet 1 Comment

The pattern for this little guy is on Furls website, here.

amigurumianimalbutterflycrochetFurlsinsectstuffed animals

Butterfly

Image 09/28/2021Karen animals, Drawings 1 Comment
artbutterflycreativedrawinsectline artline drawinglines

Butterfly

Image 01/19/2021Karen Drawings 3 Comments
artbutterflydrawdrawingline drawinglinesmodern art

Butterfly 🦋

06/11/2020Karen animals 1 Comment

20200603_133546
Isn’t this the prettiest card? Mom sent it to me. It’s one she made.

artbutterflyCardfunhand madeinspirationpretty

A Butterfly

Image 10/07/2019Karen Beaded 1 Comment
Beadbead workbeadedbeadingbutterfly

Butterfly

Image 04/21/2019Karen Watercolor Paint 1 Comment
artbutterflyfunpaintplaywaterwater colorwater color paint

Purple and Teal Butterfly

scan0213

Image 09/11/2018Karen Drawings 1 Comment
butterflydrawdrawinglinesmarkerpurpleteal

Post navigation

« Older posts

Enter your email address to follow this blog and receive notifications of new posts by email.

Join 724 other subscribers

Table of Contents

How many people have seen my BLOG?

  • 36,930 hits

What’s being said:

mtetar's avatarmtetar on Tulip and Balloon Crochet Scar…
Sandy Jandik's avatarSandy Jandik on Christmas and Snowman Scarf Cr…
Sandy Jandik's avatarSandy Jandik on Little Shells
Sandy Jandik's avatarSandy Jandik on Motif #30
puppymellow089c4d9672's avatarpuppymellow089c4d967… on Motif #30
Blog at WordPress.com.
Karen Lynne Creates
Blog at WordPress.com.
  • Subscribe Subscribed
    • Karen Lynne Creates
    • Join 622 other subscribers
    • Already have a WordPress.com account? Log in now.
    • Karen Lynne Creates
    • Subscribe Subscribed
    • Sign up
    • Log in
    • Report this content
    • View site in Reader
    • Manage subscriptions
    • Collapse this bar
 

Loading Comments...