Karen Lynne Creates

I make it. I blog it. You see it.

Menu

Skip to content
  • Home

Tag Archives: swirls

Cursive N

02/06/2018Karen Swirls 1 Comment

Cursive N

colorfulcolorscursive Nswirls

F

01/23/2018Karen Swirls 1 Comment

F

drawdrawingfgreensmarkersswirlsyellows

a

01/09/2018Karen Swirls 1 Comment

a

Adrawmarkerspinksredsswirls

Roman Numeral Twenty Six

12/27/2017Karen Swirls 1 Comment

scan0038Roman Numeral twenty six.

26colorsroman numeralswirlswirls

Cursive I

11/29/2017Karen Swirls 1 Comment

scan0031Cursive I

cursiveIswirlswirls

Cursive p

10/25/2017Karen Swirls 3 Comments

scan0026Cursive p

colored penscursivemarkersPswirlswirls

Roman Numeral 65

09/27/2017Karen Swirls 3 Comments

scan0012Roman numeral 65

65roman numeralswirlswirls

Horizontal Nonparallel Swirls

09/20/2017Karen Drawings 1 Comment

scan0047Not sure I like this one. I think it’s too random, not enough connecting lines.

blackdrawingswirlswhite

Cursive j

08/30/2017Karen Swirls 1 Comment

scan0010Cursive j

cursiveJswirlswirls

Zero

08/23/2017Karen Swirls 1 Comment

scan00080

browndrawdrawingline drawingmarkersswirlswirlsyellowzero

Post navigation

« Older posts
Newer posts »

Enter your email address to follow this blog and receive notifications of new posts by email.

Join 724 other subscribers

Table of Contents

How many people have seen my BLOG?

  • 37,521 hits

What’s being said:

mtetar's avatarmtetar on Tulip and Balloon Crochet Scar…
Sandy Jandik's avatarSandy Jandik on Christmas and Snowman Scarf Cr…
Sandy Jandik's avatarSandy Jandik on Little Shells
Sandy Jandik's avatarSandy Jandik on Motif #30
puppymellow089c4d9672's avatarpuppymellow089c4d967… on Motif #30
Blog at WordPress.com.
Karen Lynne Creates
Blog at WordPress.com.
  • Subscribe Subscribed
    • Karen Lynne Creates
    • Join 622 other subscribers
    • Already have a WordPress.com account? Log in now.
    • Karen Lynne Creates
    • Subscribe Subscribed
    • Sign up
    • Log in
    • Report this content
    • View site in Reader
    • Manage subscriptions
    • Collapse this bar
 

Loading Comments...