Karen Lynne Creates

I make it. I blog it. You see it.

Menu

Skip to content
  • Home

Tag Archives: teal

Festival of Light

11/02/2018Karen crochet 1 Comment

This one was seriously complicated to make. It was worth it, though.

crochetgreymandalaModern Crochet Mandalaspurpleteal

Scrape #9

100_4194

Image 09/23/2018Karen Acrylic Paint 1 Comment
acrylicacrylic paintpaintpurplescrapeteal

Purple and Teal Butterfly

scan0213

Image 09/11/2018Karen Drawings 1 Comment
butterflydrawdrawinglinesmarkerpurpleteal

Pendant in Layers

100_4179

Image 09/03/2018Karen Beaded 1 Comment
beadingBeadsbeadworkgreylavenderpendantpinkteal

Katie’s Baby Blanket

08/17/2018Karen crochet 3 Comments

My boss is having a baby. These are her favorite colors, and this is the baby blanket that I made for her.

 

 

 

 

 

 

Here’s a closeup. And, yes, it’s the virus blanket.

baby blanketcrochetgreypinkpurpletealvirus blanketyarn

Acrylic #3

100_4189

Image 08/01/2018Karen Acrylic Paint 1 Comment
acrylicacrylic paintgoldpaintredredsteal

Variation on the Wattle

07/20/2018Karen crochet 1 Comment

This yarn, from Blizzard Yarn and Fiber, is a bit thick, so I used a variation of the Wattle stitch. Basically I just used treble stitches instead of double stitches.

 

 

 

 

 

This is the close up. Only it’s upside down.

 

 

 

 

 

 

Here is the label from the yarn I used.

Blizzardcrochetscarftealyarn

Pendant in Teal

100_4108

Image 05/28/2018Karen Beaded 1 Comment
BeadBeadspendantsquaresteal

Dark Star

04/06/2018Karen crochet 1 Comment

This one was very interesting to make. You start with the triangles, then do the center, then do the outer. I had my doubts, but it turned out.

crochetdark stargreyModern Crochet Mandalasteal

Crochet Brown on Teal

03/12/2018Karen crochet 1 Comment

I like this pattern.

 

 

 

 

 

 

 

Herre’s the template.

BeadsBraceletbrowncrochettealyarn

Post navigation

« Older posts
Newer posts »

Enter your email address to follow this blog and receive notifications of new posts by email.

Join 724 other subscribers

Table of Contents

How many people have seen my BLOG?

  • 37,413 hits

What’s being said:

mtetar's avatarmtetar on Tulip and Balloon Crochet Scar…
Sandy Jandik's avatarSandy Jandik on Christmas and Snowman Scarf Cr…
Sandy Jandik's avatarSandy Jandik on Little Shells
Sandy Jandik's avatarSandy Jandik on Motif #30
puppymellow089c4d9672's avatarpuppymellow089c4d967… on Motif #30
Blog at WordPress.com.
Karen Lynne Creates
Blog at WordPress.com.
  • Subscribe Subscribed
    • Karen Lynne Creates
    • Join 622 other subscribers
    • Already have a WordPress.com account? Log in now.
    • Karen Lynne Creates
    • Subscribe Subscribed
    • Sign up
    • Log in
    • Report this content
    • View site in Reader
    • Manage subscriptions
    • Collapse this bar
 

Loading Comments...