Karen Lynne Creates

I make it. I blog it. You see it.

Menu

Skip to content
  • Home

Tag Archives: yellows

F

01/23/2018Karen Swirls 1 Comment

F

drawdrawingfgreensmarkersswirlsyellows

Bargello in Yellows and Browns

06/14/2017Karen Drawings 3 Comments

scan0034This Bargello is two in one. I stated with one pattern in browns, then started another pattern in yellows.

Bargellobrownsdrawdrawingmarkersyellows

Enter your email address to follow this blog and receive notifications of new posts by email.

Join 724 other subscribers

Table of Contents

How many people have seen my BLOG?

  • 37,413 hits

What’s being said:

mtetar's avatarmtetar on Tulip and Balloon Crochet Scar…
Sandy Jandik's avatarSandy Jandik on Christmas and Snowman Scarf Cr…
Sandy Jandik's avatarSandy Jandik on Little Shells
Sandy Jandik's avatarSandy Jandik on Motif #30
puppymellow089c4d9672's avatarpuppymellow089c4d967… on Motif #30
Blog at WordPress.com.
  • Subscribe Subscribed
    • Karen Lynne Creates
    • Join 622 other subscribers
    • Already have a WordPress.com account? Log in now.
    • Karen Lynne Creates
    • Subscribe Subscribed
    • Sign up
    • Log in
    • Report this content
    • View site in Reader
    • Manage subscriptions
    • Collapse this bar
 

Loading Comments...