Karen Lynne Creates

I make it. I blog it. You see it.

Menu

Skip to content
  • Home

Tag Archives: pink

Overlapping Triangle Pendant

Image 11/12/2018Karen Beaded 1 Comment
bead workbeadingBeadsbluependantpink

Snail

Image 11/06/2018Karen Drawings 4 Comments
browndrawdrawingline drawingmarkermarkerspinksnail

Rabbit

Image 10/30/2018Karen Drawings 2 Comments
artbunnydrawdrawingmarkermarkerspinkrabbit

X Pendant

Image 10/15/2018Karen Beaded 1 Comment
BeadsbluegreenpendantpinkX

Purple and Pink Triangles on White Pendant

Image 10/01/2018Karen Beaded 1 Comment
beadingBeadspendantpinkpurplewhite

Diamonds

09/14/2018Karen crochet 1 Comment

This interlocking crochet pattern is called Diamonds.

 

 

 

 

 

The back side.

crochetinterlockinginterlocking crochetInterlocking Crochet PatternspinkpurpleTanis Galik

Acrylic #9

100_4200

Image 09/12/2018Karen Acrylic Paint 1 Comment
acrylicacrylic paintartbluepaintpink

Pendant in Layers

100_4179

Image 09/03/2018Karen Beaded 1 Comment
beadingBeadsbeadworkgreylavenderpendantpinkteal

Crochet Yellow, Pink and Blue on White

08/27/2018Karen crochet 1 Comment

100_4182

scan0221

BeadsblueBraceletcrochetcuffpinkwhiteyellow

Katie’s Baby Blanket

08/17/2018Karen crochet 3 Comments

My boss is having a baby. These are her favorite colors, and this is the baby blanket that I made for her.

 

 

 

 

 

 

Here’s a closeup. And, yes, it’s the virus blanket.

baby blanketcrochetgreypinkpurpletealvirus blanketyarn

Post navigation

« Older posts
Newer posts »

Enter your email address to follow this blog and receive notifications of new posts by email.

Join 724 other subscribers

Table of Contents

How many people have seen my BLOG?

  • 35,151 hits

What’s being said:

mtetar's avatarmtetar on Tulip and Balloon Crochet Scar…
Sandy Jandik's avatarSandy Jandik on Christmas and Snowman Scarf Cr…
Sandy Jandik's avatarSandy Jandik on Little Shells
Sandy Jandik's avatarSandy Jandik on Motif #30
puppymellow089c4d9672's avatarpuppymellow089c4d967… on Motif #30
Blog at WordPress.com.
Karen Lynne Creates
Blog at WordPress.com.
  • Subscribe Subscribed
    • Karen Lynne Creates
    • Join 622 other subscribers
    • Already have a WordPress.com account? Log in now.
    • Karen Lynne Creates
    • Subscribe Subscribed
    • Sign up
    • Log in
    • Report this content
    • View site in Reader
    • Manage subscriptions
    • Collapse this bar
 

Loading Comments...