Karen Lynne Creates

I make it. I blog it. You see it.

Menu

Skip to content
  • Home

Author Archives: Karen

Granny 8

11/07/2018Karen crochet 1 Comment

 

 

 

 

design by Carole Prior

99 Granny Squares to Crochetcrochetgrannygranny squareyarn

Snail

Image 11/06/2018Karen Drawings 4 Comments
browndrawdrawingline drawingmarkermarkerspinksnail

Crochet Yellow and Green on Green

11/05/2018Karen Beaded 1 Comment

 

 

 

 

 

 

BeadsBraceletbuttoncrochetcuffgreenyellow

Ink and Water

11/04/2018Karen paint 1 Comment

This is what happens when you brush water over dried ink. It has potential.

experimentexploreinkpintplayredwater

Betrayed

scan0260via Betrayed

Quote 11/03/2018Karen the Daily Post 2 Comments
BetrayedBuddycatdaily postdaily promptdaily wordhumorthe Daily Postword of the day

Festival of Light

11/02/2018Karen crochet 1 Comment

This one was seriously complicated to make. It was worth it, though.

crochetgreymandalaModern Crochet Mandalaspurpleteal

Nap Time

11/01/2018Karen animals 2 Comments

Playing is exhausting.

He snores, too. Never thought snoring would be so cute.

animalsBradycutepetspuppy

Granny 7

10/31/2018Karen crochet 1 Comment

 

 

 

 

design by Irene Johnson

99 Granny Squares to Crochetcrochetgrannygranny squareSquareyarn

Rabbit

Image 10/30/2018Karen Drawings 2 Comments
artbunnydrawdrawingmarkermarkerspinkrabbit

Pendant Swirl

10/29/2018Karen Beaded 1 Comment

bead workbeadingBeadsbluegreenpendantred

Post navigation

« Older posts
Newer posts »

Enter your email address to follow this blog and receive notifications of new posts by email.

Join 724 other subscribers

Table of Contents

How many people have seen my BLOG?

  • 41,784 hits

What’s being said:

mtetar's avatarmtetar on Tulip and Balloon Crochet Scar…
Sandy Jandik's avatarSandy Jandik on Christmas and Snowman Scarf Cr…
Sandy Jandik's avatarSandy Jandik on Little Shells
Sandy Jandik's avatarSandy Jandik on Motif #30
puppymellow089c4d9672's avatarpuppymellow089c4d967… on Motif #30
Blog at WordPress.com.
Karen Lynne Creates
Blog at WordPress.com.
  • Subscribe Subscribed
    • Karen Lynne Creates
    • Join 622 other subscribers
    • Already have a WordPress.com account? Log in now.
    • Karen Lynne Creates
    • Subscribe Subscribed
    • Sign up
    • Log in
    • Report this content
    • View site in Reader
    • Manage subscriptions
    • Collapse this bar

Loading Comments...